PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf03422g00031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family CO-like
Protein Properties Length: 381aa    MW: 43842.6 Da    PI: 4.5567
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf03422g00031.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.11.1e-051331440
                  zf-B_box 14 lqlfCedCqqllCedClleeHkg......Htvv 40
                              +++fC  ++ +lC++C ++ H+       H++v
  Peinf101Scf03422g00031.1  1 ARWFCPADDAFLCQSCDVSVHSAnqlasrHERV 33
                              689******************667888888876 PP

2CCT682.5e-23324367144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  Peinf101Scf03422g00031.1 324 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRT 367
                               9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000217.48E-8135No hitNo description
PROSITE profilePS501199.001135IPR000315B-box-type zinc finger
PfamPF062037.0E-18324366IPR010402CCT domain
PROSITE profilePS5101716.043324366IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
ARWFCPADDA FLCQSCDVSV HSANQLASRH ERVRLETSSN KSNETKSDQN CQPAWHQGFT  60
RKARTPRNGK NKILIGQRKK DEENMVPEIG SDNSPDIENE FENEEQLLYR VPIFDPFAAE  120
LCIVSNEVLD ETTTINDLDI LLNDDDDLGI PEFLSTDMEL AEFAADVESL LGEEFTVVEQ  180
EEQSQLSNAA VEDNKAIKIE VEDEEMRAVV ACHLDPELDM AREALNWDFE YEEAVEQKVM  240
ADTNEFVPSD STDNRIDAKR RLLLRLNHEA VITAWPNQSS PWTDGVRPHF NPDDCWPDFL  300
ETWPGEGGSH QTYGGHVRGG DEGREARVSR YREKRRTRLF SKKIRYEVRK LNAEKRPRLK  360
GRFVKRTSFS EPGFPYLMNK R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1334350RRTRLFSKKIRYEVRKL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755153e-31HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603861.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
RefseqXP_016434941.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
TrEMBLM1A4330.0M1A433_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000143620.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15392470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.11e-74B-box type zinc finger protein with CCT domain